ω-Agatoxin TK
158484-42-5 Basic informationMore
- Product Name:ω-Agatoxin TK
- Synonyms: Ω-AGATOXIN TK Cys14-Cys33 Cys18-Cys35) H-Gly-Val-Pro-Ile-Asn-Val-Ser-Cys-Thr-Gly-Ser-Pro-Gln-Cys-Ile-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys-OH(Disulfide bridge:Cys8-Cys28
- CAS:158484-42-5
- MF:C215H337N65O70S10
- MW:5273.01978
- EINECS:
- Mol File:158484-42-5.mol
Browse by Nationality 158484-42-5 Suppliers >Global suppliers
Shanghai (6) Tianjin (1) Guangdong (1) Zhejiang (9) Shanxi (1) Henan (1) Anhui (1) Jiangsu (6) Member (26) All (26)
Please select the suppliers
Recommend You Select Member Companies
Recommend You Select Member Companies
- Company Name:3B Pharmachem (Wuhan) International Co.,Ltd.
- Tel:821-50328103-801 18930552037
- Products Intro:Product Name:ω-Agatoxin TK
CAS:158484-42-5
Purity:99% HPLC Package:1Mg ; 5Mg;10Mg ;100Mg;250Mg ;500Mg ;1g;2.5g ;5g ;10g More... - CB Index:69
- Related Information:Catalog(15848)
- Company Name:Sigma-Aldrich
- Tel:021-61415566 800-8193336
- Products Intro:Product Name:omega-Agatoxin TK
CAS:158484-42-5
Purity:~98% (HPLC), powder Package:.1MG Remarks:A2202-.1MG - CB Index:80
- Related Information:Catalog(51471)
- Company Name:Nanjing Leon Biological Technology Co., Ltd.
- Tel: 17705183659
- Products Intro:Product Name:ω-Agatoxin TK
CAS:158484-42-5
Remarks:EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA (Modifications: Disulfide bridge between 4 - 20, 12 - 25, 19 - 36, 27 - 34) More... - CB Index:55
- Related Information:Catalog(5502)
- Company Name:Nanjing Peptide Biotech Ltd.
- Tel:025-025-58361106-805-805 13082558573
- Products Intro:Product Name:ω-Agatoxin TK
CAS:158484-42-5
Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC More... - CB Index:55
- Related Information:Catalog(9978)
- Company Name:Hangzhou Peptidego Biotech Co.,Ltd.
- Tel:0571-87213919
- Products Intro:Product Name:ω-Agatoxin TK
CAS:158484-42-5
Purity:95% or 98% Package:1mg;5mg;10mg;50mg;100mg,1g or according to customer's detail requirement. - CB Index:58
- Related Information:Catalog(6757)
- Company Name:Career Henan Chemica Co
- Tel:+86-0371-86658258 +8613203830695
- Products Intro:Product Name:ω-Agatoxin TK
CAS:158484-42-5
Purity:99% Package:1KG;7USD - CB Index:58
- Related Information:Catalog(30250)
- Company Name:Hangzhou Go Top Peptide Biotech
- Tel:0571-88211921 13355716090
- Products Intro:Product Name:Agitoxin-2
CAS:158484-42-5
Purity:95%-98% HPLC Package:1mg;10mg;100mg;1g;100g - CB Index:58
- Related Information:Catalog(2850)